Skip to Content

ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 12(PCR12)

https://www.nuclineers.com/web/image/product.template/117041/image_1920?unique=a9584cd
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9SX26 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYGNGPVFKAEGTSFRDQPYAEQLPQGLWTTGLCDCHEDAHICVQTAIMPCVSFAQNVEI VNRGTIPCMNAGLIHLALGFIGCSWLYAFPNRSRLREHFALPEEPCRDFLVHLFCTPCAI CQESRELKNRGADPSIGWLSNVEKWSREKVTPPIVVPGMIR Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 12 Short name= AtPCR12 Gene Names:Name:PCR12 Ordered Locus Names:At1g68630 ORF Names:F24J5.13 Expression Region:1-161 Sequence Info:fµLl length protein

1,505.00 € 1505.0 EUR 1,505.00 €

1,505.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days